| Id: | acc3869 |
| Group: | 1sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | phosphorylation |
| Site: | Thr180 |
| Site Sequence: | LARHTDDEMTGYVATRWYRAP |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | streptozotocin + arjunolic acid |
| Drug Info: | Streptozotocin is a chemotherapeutic agent used in the treatment of pancreatic cancer. | Arjunolic acid has various pharmacological activities such as anti - inflammatory and antioxidant properties. |
| Effect: | modulate |
| Effect Info: | "In our study, STZ exposure led to an increase in the immunoreactive concentrations of phosphorylated ERK, phosphorylated JNK, and phosphorylated p38 in diabetic spleen tissues, which could be reduced by AA treatment. However, treating animals with AA alone had no effect on the expression of phosphorylated MAPKs." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 20053369 |
| Sentence Index: | 20053369_3 |
| Sentence: | STZ administration elevated the levels of IL-2 as well as IFN-gamma and attenuated the level of TNF-alpha in the sera of diabetic animals. |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
