| Id: | acc3873 |
| Group: | 1sens |
| Protein: | p65 |
| Gene Symbol: | Rela |
| Protein Id: | P58546 |
| Protein Name: | MTPN_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser536 |
| Site Sequence: | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial I/R Injury |
| Disease Subtype: | diabetic |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Tanshinone IIA |
| Drug Info: | "Tanshinone IIA is a lipophilic diterpene quinone isolated from Salvia miltiorrhiza, which has various pharmacological activities such as anti - inflammatory and anti - oxidative effects." |
| Effect: | modulate |
| Effect Info: | The protective effect of tanshinone on myocardial ischemia/reperfusion (I/R) injury in diabetic rats by enhancing the phosphorylation of Akt and inhibiting the phosphorylation of NF–κB via the PI3K/Akt pathway. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 20380652 |
| Sentence Index: | 20380652_10 |
| Sentence: | "Moreover, pretreatment with wortmannin abolished the beneficial effects of TSN: a reduction of infarct size, a decrease in LVEF, inhibition of myocardial apoptosis and Akt phosphorylation, enhancement of NF-kappaB phosphorylation and an increase of cytokine production including TNF-alpha and IL-6 after I/R injury in diabetic rats." |
Sequence & Structure:
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
