Id: | acc3883 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P47811 |
Protein Name: | MK14_MOUSE |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Dilated Cardiomyopathy |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Propylthiouracil (PTU) |
Drug Info: | Propylthiouracil (PTU) is an antithyroid drug used to treat hyperthyroidism by reducing the production of thyroid hormones. |
Effect: | modulate |
Effect Info: | "The phosphorylation levels of Akt and p38 mitogen-activated protein kinase (p38 MAPK) were elevated in the hearts of DCM mice, and PTU treatment significantly reduced these phosphorylation levels. This strongly indicates that the upregulation of Dio2 is involved in cardiac remodeling in DCM by activating the TH signaling pathway involving Akt and p38 MAPK." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 20453157 |
Sentence Index: | 20453157_9 |
Sentence: | "Akt and p38 mitogen-activated protein kinase (p38 MAPK) phosphorylation increased in the DCM mice hearts and PTU treatment significantly reduced the phosphorylation levels, strongly suggesting that Dio2 up-regulation is involved in cardiac remodelling in DCM through activating the TH-signalling pathways involving Akt and p38 MAPK." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.