| Id: | acc3888 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | Tyr187 |
| Site Sequence: | HTGFLTEYVATRWYRAPEIML |
| Disease Category: | Immune system diseases |
| Disease: | Multiple Sclerosis |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Dimethylfumarate (DMF) |
| Drug Info: | "Dimethylfumarate (DMF) is a drug used in the treatment of certain medical conditions, such as multiple sclerosis." |
| Effect: | modulate |
| Effect Info: | "Pretreatment with DMF can reduce the synthesis of pro - inflammatory mediators iNOS, TNF - alpha, IL - 1beta and IL - 6 at the RNA level in in vitro - activated microglia and astrocytes, and simultaneously reduce ERK phosphorylation in microglia." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 20482831 |
| Sentence Index: | 20482831_0 |
| Sentence: | "Dimethylfumarate inhibits microglial and astrocytic inflammation by suppressing the synthesis of nitric oxide, IL-1beta, TNF-alpha and IL-6 in an in-vitro model of brain inflammation." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
| T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
| Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
| T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
| Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
