Id: | acc3894 |
Group: | 1sens |
Protein: | p38 |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | Phosphorylation |
Site: | Tyr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Pain syndromes |
Disease: | Postoperative Allodynia |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Morphine |
Drug Info: | Morphine is a potent opioid analgesic commonly used for the relief of severe pain. |
Effect: | modulate |
Effect Info: | Chronic morphine administration inhibits the relief process of postoperative mechanical allodynia by promoting the phosphorylation of p38 and ERK in microglia. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 20493931 |
Sentence Index: | 20493931_10 |
Sentence: | "Together, these data demonstrate that chronic morphine administration attenuates the resolution of postoperative allodynia in association with microglial p38 and extracellular receptor kinase (ERK) phosphorylation, independent of changes in Iba1 and GFAP expression." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.