| Id: | acc3900 |
| Group: | 1sens |
| Protein: | H2AX |
| Gene Symbol: | H2AX |
| Protein Id: | P16104 |
| Protein Name: | H2AX_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser139 |
| Site Sequence: | PSGGKKATQASQEY------- |
| Disease Category: | Cancer |
| Disease: | Colorectal Cancer |
| Disease Subtype: | |
| Disease Cellline: | HT-29 |
| Disease Info: | |
| Drug: | fisetin + radiation |
| Drug Info: | Fisetin is a natural flavonoid with potential antioxidant and anti - inflammatory properties | Radiation is a physical therapy method often used in cancer treatment to kill cancer cells. |
| Effect: | suppress |
| Effect Info: | Fisetin can enhance the radiosensitivity of human colon cancer HT–29 cells with p53 mutation by downregulating protein phosphorylation. |
| Note: | "drug comb,histone" |
| Score: | 4.0 |
| Pubmed(PMID): | 20637980 |
| Sentence Index: | 20637980_4 |
| Sentence: | "Western blot analysis was performed to ascertain the protein levels of gamma-H2AX, phospho-Chk2, active caspase-3, PARP cleavage, phospho-p38, phospho-AKT, and phospho-ERK1/2. RESULTS: Fisetin pretreatment enhanced the radiosensitivity of p53-mutant HT-29 human colorectal cancer cells but not human keratocyte HaCaT cells; it also prolonged radiation-induced G(2)/M arrest, enhanced radiation-induced cell growth arrest in HT-29 cells, and suppressed radiation-induced phospho-H2AX (Ser-139) and phospho-Chk2 (Thr-68) in p53-mutant HT-29 cells. Fisetin could potentially be developed as a novel radiosensitizer against radioresistant human cancer cells." |
Sequence & Structure:
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 139 | U | Acute myelogenous leukemia | Phosphorylation | 33691101 |
| S | 139 | U | Hepatocellular carcinoma | Phosphorylation | 25537504 |
| S | 139 | U | Multiple myeloma | Phosphorylation | 35190641 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
