Id: acc3915
Group: 1sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: P18266
Protein Name: GSK3B_RAT
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Myocardial Infarction
Disease Subtype: STZ induced diabetes mellitus
Disease Cellline:
Disease Info:
Drug: EPO
Drug Info: "EPO, or erythropoietin, is a hormone that stimulates the production of red blood cells. It is sometimes misused in sports as a performance - enhancing drug."
Effect: no effect
Effect Info: "In the hearts of healthy rats, EPO can significantly reduce the myocardial infarction area and enhance the phosphorylation of Akt, ERK1/2, and GSK - 3β. However, in STZ - induced diabetic rats, EPO fails to produce a protective effect."
Note:
Score: 2.0
Pubmed(PMID): 20981553
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: