| Id: | acc3915 |
| Group: | 1sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial Infarction |
| Disease Subtype: | STZ induced diabetes mellitus |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | EPO |
| Drug Info: | "EPO, or erythropoietin, is a hormone that stimulates the production of red blood cells. It is sometimes misused in sports as a performance - enhancing drug." |
| Effect: | no effect |
| Effect Info: | "In the hearts of healthy rats, EPO can significantly reduce the myocardial infarction area and enhance the phosphorylation of Akt, ERK1/2, and GSK - 3β. However, in STZ - induced diabetic rats, EPO fails to produce a protective effect." |
| Note: | |
| Score: | 2.0 |
| Pubmed(PMID): | 20981553 |
| Sentence Index: | 20981553_7 |
| Sentence: | "In hearts from STZ-induced diabetic rats, EPO did not decrease infarct size (32.05 +- 2.38 and 31.88 +- 1.87% in EPO-treated and untreated diabetic rat hearts, respectively, NS) nor did it increase phosphorylation of Akt, ERK1/2, and GSK-3beta." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
