| Id: | acc3918 |
| Group: | 1sens |
| Protein: | NR2B |
| Gene Symbol: | Grin2b |
| Protein Id: | Q62923 |
| Protein Name: | PNOC_RAT |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Nervous system diseases |
| Disease: | Changes In Sensory Pathway Properties |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | CYP |
| Drug Info: | "CYP refers to Cytochrome P450, a family of enzymes involved in the metabolism of various drugs and endogenous compounds." |
| Effect: | modulate |
| Effect Info: | CYP may promote the enhancement of spinal reflexes through nitric oxide and Cdk5-dependent NR2B phosphorylation. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 21106858 |
| Sentence Index: | 21106858_6 |
| Sentence: | These results suggested that CYP might facilitate spinal reflex potentiation mediated by N-methyl-d-aspartate receptors and participate in the development of visceral hypereflexia/hyperalgesia through nitric oxide- and Cdk5-dependent NR2B phosphorylation at the lumbosacral dorsal horn. |
Sequence & Structure:
MKILFCDVLLLSLLSSVFSSCPEDCLTCQERLHPAPGSFNLKLCILQCEEKVFPRPLWTLCTKAMASDSEQLSPADPELTSAALYQSKASEMQHLKRMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
