| Id: | acc3938 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr185 |
| Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | insulin resistance |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | H2O2 |
| Drug Info: | "H2O2 is hydrogen peroxide, a common disinfectant and oxidizing agent." |
| Effect: | modulate |
| Effect Info: | "Chronic treatment of HL–1 adult cardiomyocytes with hydrogen peroxide leads to insulin resistance, accompanied by excessive phosphorylation of ERK. The ERK inhibitor U0126 can enhance insulin sensitivity, while the PI3K inhibitor LY294002 exacerbates insulin resistance." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 21270272 |
| Sentence Index: | 21270272_8 |
| Sentence: | "In the hearts of streptozotocin-induced diabetic mice and diabetic patients Nrf2 expression significantly decreased along with significant increases in 3-nitrotyrosine accumulation and ERK phosphorylation, whereas these pathogenic changes were not observed in the heart of diabetic mice with cardiac-specific overexpression of a potent antioxidant metallothionein." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
| T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
| T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
