| Id: | acc3962 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Musculoskeletal system diseases |
| Disease: | Muscular Dystrophy |
| Disease Subtype: | mdx mouse model |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | AT-1 receptor blockers (ARB) |
| Drug Info: | "AT - 1 receptor blockers (ARB) are drugs that block the action of angiotensin II at the AT - 1 receptor, which helps lower blood pressure." |
| Effect: | modulate |
| Effect Info: | "ARB significantly reduced the levels of extracellular matrix proteins, α–SMA, and ERK–1/2 phosphorylation induced by CTGF overexpression and effectively prevented the loss of skeletal muscle contractility, demonstrating the potential of ARB as a novel drug tool for treating fibrosis associated with muscular dystrophy." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 21645240 |
| Sentence Index: | 21645240_10 |
| Sentence: | "Finally, we show that ARB decreased the levels of fibrotic proteins, CTGF and ERK-1/2 phosphorylation augmented in a dystrophic skeletal muscle from mdx mice." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
