| Id: | acc3970 |
| Group: | 1sens |
| Protein: | p38 MAP kinase |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Nervous system diseases |
| Disease: | Mania-Like Behavior |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Ouabain |
| Drug Info: | Ouabain is a cardiac glycoside that can be used to increase the force of heart contractions and is commonly used in the study of cardiac function. |
| Effect: | modulate |
| Effect Info: | "Ouabain → Inhibition of Na/K-ATPase → Activation of ERK1/2 (↑ phosphorylation) → ↑ Phosphorylation of p90RSK → ↑ Phosphorylation of TH → ↑ Dopamine synthesis → ↑ Mania-like behavior. Ouabain treatment also leads to a decrease in the phosphorylation of CaMKIIα and p38, which are related to neuromodulation. " |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 21871514 |
| Sentence Index: | 21871514_3 |
| Sentence: | "Previously, we have reported that intracerebroventricular (ICV) injection of ouabain, a selective Na/K-ATPase inhibitor, induces hyperactivity in rats that mimics manic symptoms related to the activation of extracellular signal-regulated protein kinase1/2 (ERK1/2), which plays crucial roles in the modulation of TH phosphorylation." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
