Id: acc3998
Group: 1sens
Protein: p38
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Tyr182
Site Sequence: RHTDDEMTGYVATRWYRAPEI
Disease Category: Cardiovascular and circulatory system diseases
Disease: Barrier Dysfunction
Disease Subtype: vascular endothelial dysfunction
Disease Cellline: HPAEC
Disease Info:
Drug: 2-methoxyestradiol(2-ME)
Drug Info: 2-methoxyestradiol (2-ME) is a synthetic derivative of estradiol with potential anti-angiogenic and anti-tumor properties.
Effect: modulate
Effect Info: "2ME can significantly promote the phosphorylation of p38 mitogen-activated protein kinase (p38) and myosin light chain (MLC). This process is dependent on the Rho kinase (ROCK) signaling pathway, leading to endothelial cell contraction and impaired barrier function."
Note:
Score: 4.0
Pubmed(PMID): 22074808
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: