| Id: | acc3998 |
| Group: | 1sens |
| Protein: | p38 |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Barrier Dysfunction |
| Disease Subtype: | vascular endothelial dysfunction |
| Disease Cellline: | HPAEC |
| Disease Info: | |
| Drug: | 2-methoxyestradiol(2-ME) |
| Drug Info: | 2-methoxyestradiol (2-ME) is a synthetic derivative of estradiol with potential anti-angiogenic and anti-tumor properties. |
| Effect: | modulate |
| Effect Info: | "2ME can significantly promote the phosphorylation of p38 mitogen-activated protein kinase (p38) and myosin light chain (MLC). This process is dependent on the Rho kinase (ROCK) signaling pathway, leading to endothelial cell contraction and impaired barrier function." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 22074808 |
| Sentence Index: | 22074808_8 |
| Sentence: | "Inhibition of histone deacetylase 6 (HDAC6) with tubacin increases tubulin acetylation level, suppresses 2ME-induced HSP27 and MLC phosphorylation, and decreases 2ME-induced barrier dysfunction, suggesting barrier-protective and/or barrier-restorative role for tubulin acetylation in vascular endothelium." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
