| Id: | acc4020 |
| Group: | 1sens |
| Protein: | DOR |
| Gene Symbol: | Oprd1 |
| Protein Id: | P33533 |
| Protein Name: | OPRD_RAT |
| PTM: | phosphorylation |
| Site: | Thr161 |
| Site Sequence: | HPVKALDFRTPAKAKLINICI |
| Disease Category: | Immune system diseases |
| Disease: | Inflammatory |
| Disease Subtype: | Inflammatory Pain (CFA Model) |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Morphine |
| Drug Info: | Morphine is a potent opioid analgesic commonly used for the relief of severe pain. |
| Effect: | tolerate |
| Effect Info: | "In the rat model of CFA-induced inflammatory pain, Cdk5-mediated phosphorylation of the Thr-161 site of the DOR receptor can enhance morphine tolerance and inhibit hyperalgesia. Blocking the phosphorylation of this site can significantly relieve morphine tolerance, suggesting that phosphorylation of DOR Thr-161 is a key mechanistic target for regulating the effects of opioids." |
| Note: | |
| Score: | 5.0 |
| Pubmed(PMID): | 22466129 |
| Sentence Index: | 22466129_8 |
| Sentence: | "CONCLUSION: Phosphorylation of DOR at Thr-161 by Cdk5 attenuates hypersensitivity and potentiates morphine tolerance in rats with CFA-induced inflammatory pain, while disruption of the phosphorylation of DOR at Thr-161 attenuates morphine tolerance." |
Sequence & Structure:
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
