Id: | acc4021 |
Group: | 1sens |
Protein: | FOXO1 |
Gene Symbol: | Foxo1 |
Protein Id: | Q9R1E0 |
Protein Name: | FOXO1_MOUSE |
PTM: | phosphorylation |
Site: | Ser256 |
Site Sequence: | PRRRAASMDNNSKFAKSRGRA |
Disease Category: | Nervous system diseases |
Disease: | Cognitive Abnormalities |
Disease Subtype: | Cognitive Deficits |
Disease Cellline: | |
Disease Info: | |
Drug: | domoic acid |
Drug Info: | Domoic acid is a neurotoxin produced by certain marine algae. It can cause amnesic shellfish poisoning in humans when consumed through contaminated shellfish. |
Effect: | modulate |
Effect Info: | "Kainic acid promotes the phosphorylation of p47phox by activating PKC-ζ, which in turn activates the phosphorylation of JNK and inhibits the phosphorylation of FoxO1, ultimately leading to neuronal apoptosis and cognitive deficits." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22474074 |
Sentence Index: | 22474074_7 |
Sentence: | "In turn, the abnormal ROS levels in the hippocampus of DA-treated mice activated SAPK/JNK pathway, decreased FoxO1 phosphorylation, stimulated the nuclear translocation of FoxO1, activated FasL/Fas signaling, and promoted the activation of caspase-8 and caspase-3, which resulted in neuron apoptosis and cognitive deficits in mice." |
Sequence & Structure:
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.