| Id: | acc4031 |
| Group: | 1sens |
| Protein: | MnSOD |
| Gene Symbol: | Sod2 |
| Protein Id: | P09671 |
| Protein Name: | SODM_MOUSE |
| PTM: | nitration |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Refractory Wounds |
| Disease Subtype: | refractory wounds of type 1 diabetic |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Ganoderma lucidum polysaccharide(Gl-PS) |
| Drug Info: | "Ganoderma lucidum polysaccharide (Gl - PS) is a polysaccharide derived from Ganoderma lucidum, which may possess various biological activities." |
| Effect: | modulate |
| Effect Info: | Ganoderma lucidum polysaccharides (Gl–PS) improve wound angiogenesis by inhibiting the nitration of MnSOD and the phosphorylation of p66Shc. These results indicate that Gl–PS effectively promotes wound healing in type 1 diabetic mice. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 22508065 |
| Sentence Index: | 22508065_8 |
| Sentence: | "CONCLUSION: Gl-PS rescued the delayed wound healing and improved wound angiogenesis in STZ-induced type 1 diabetic mice, at least in part, by suppression of cutaneous MnSOD nitration, p66Shc and mitochondrial oxidative stress." |
Sequence & Structure:
MLCRAACSTGRRLGPVAGAAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
