Id: acc4041
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63086
Protein Name: MK01_RAT
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Cardiovascular and circulatory system diseases
Disease: Myocardial Fibrosis
Disease Subtype: DOCA induced
Disease Cellline:
Disease Info:
Drug: ALI
Drug Info: ALI is a drug.
Effect: modulate
Effect Info: ALI inhibits myocardial fibrosis and reduces the phosphorylation level of ERK1/2 in the heart.
Note:
Score: 4.0
Pubmed(PMID): 22642589
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - A Basophilic leukemia Phosphorylation 11971018

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: