| Id: | acc4046 |
| Group: | 1sens |
| Protein: | PLN |
| Gene Symbol: | Pln |
| Protein Id: | P61016 |
| Protein Name: | PPLA_RAT |
| PTM: | phosphorylation |
| Site: | Ser16 |
| Site Sequence: | LTRSAIRRASTIEMPQQARQN |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Diastolic Dysfunction |
| Disease Subtype: | D-galactose-induced aging |
| Disease Cellline: | cardiomyocytes |
| Disease Info: | |
| Drug: | EGb761 |
| Drug Info: | "EGb761 is a standardized Ginkgo biloba extract, which is often used in the field of medicine for its potential health - related benefits." |
| Effect: | modulate |
| Effect Info: | EGb761 improves diastolic dysfunction in senescent cardiomyocytes by increasing phosphorylation of PLN at Ser16/Thr17. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 22693651 |
| Sentence Index: | 22693651_8 |
| Sentence: | "The study indicated that EGb761 alleviates formation of AGEs products on SERCA2a in order to mitigate myocardial stiffness on one hand; on other hand, improve SERCA2a function through increase the amount of Ser16 sites PLN phosphorylation, which two hands finally led to ameliorate diastolic dysfunction of aging cardiomyocytes." |
Sequence & Structure:
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
