Id: acc4072
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Tyr187
Site Sequence: HTGFLTEYVATRWYRAPEIML
Disease Category: Digestive system diseases
Disease: Pancreatitis
Disease Subtype: Chronic pancreatitis
Disease Cellline:
Disease Info:
Drug: Sulindac
Drug Info: "Sulindac is a non - steroidal anti - inflammatory drug (NSAID) used to relieve pain, swelling, and inflammation."
Effect: modulate
Effect Info: "When Sulindac was used to treat chronic pancreatic tissue, it significantly inhibited the phosphorylation levels of MEK and ERK, indicating that the drug may exert its therapeutic effect by reducing the activity of the MEK/ERK signaling pathway."
Note:
Score: 4.0
Pubmed(PMID): 22920325
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: