| Id: | acc4098 |
| Group: | 1sens |
| Protein: | PPARgamma |
| Gene Symbol: | Pparg |
| Protein Id: | P37238 |
| Protein Name: | PPARG_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser273 |
| Site Sequence: | ILTGKTTDKSPFVIYDMNSLM |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | C333H |
| Drug Info: | "C333H is a drug with a chemical formula of C333H, which may have specific pharmacological properties and potential medical applications." |
| Effect: | modulate |
| Effect Info: | "C333H can increase the level of high - molecular - weight adiponectin isoforms in the circulation, reduce the phosphorylation of serine at position 273 of PPARγ in brown adipose tissue, and improve insulin resistance." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 23563593 |
| Sentence Index: | 23563593_7 |
| Sentence: | "In diabetic db/db mice, C333H elevated circulating high molecular weight adiponectin isoforms, decreased PPARgamma 273 serine phosphorylation in brown adipose tissue and selectively modulated the expression of a subset of PPARgamma target genes in adipose tissue." |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
