| Id: | acc4111 |
| Group: | 1sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr180 |
| Site Sequence: | LARHTDDEMTGYVATRWYRAP |
| Disease Category: | Immune system diseases |
| Disease: | Colitis |
| Disease Subtype: | Ulcerative Colitis |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | flavonoid myricitrin |
| Drug Info: | Flavonoid myricitrin is a type of flavonoid compound that may have various biological activities. |
| Effect: | modulate |
| Effect Info: | The flavonoid myricitrin can exert anti-inflammatory effects by regulating the phosphorylation levels of factors related to the PI3K/Akt signaling pathway. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 23861337 |
| Sentence Index: | 23861337_5 |
| Sentence: | Our results showed that oral treatment with myricitrin exerts consistent anti-inflammatory action in DSS-induced acute colitis in mice by the inhibition of the Akt/phosphatidylinositol-3 kinase-dependent phosphorylation. |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
