Id: acc4137
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: Diabetic Peripheral Neuropathy
Disease Cellline:
Disease Info:
Drug: "cinnamyl-3,4-dihydroxy-α-cyanocinnamate (CDC)"
Drug Info: "Cinnamyl-3,4-dihydroxy-α-cyanocinnamate (CDC) is a chemical compound that may have certain pharmacological activities in the field of medicine or pharmacology."
Effect: modulate
Effect Info: "Pharmacological inhibition of 12/15-lipoxygenase inhibits excessive p38 MAPK and ERK but not SAPK/JNK phosphorylation in the sciatic nerves of diabetic mice, alleviates nerve fiber dysfunction, suggesting it may serve as an effective treatment for diabetic peripheral neuropathy."
Note:
Score: 4.0
Pubmed(PMID): 24175152
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: