| Id: | acc4138 |
| Group: | 1sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | Diabetic Peripheral Neuropathy |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | "cinnamyl-3,4-dihydroxy-α-cyanocinnamate (CDC)" |
| Drug Info: | "Cinnamyl-3,4-dihydroxy-α-cyanocinnamate (CDC) is a chemical compound that may have certain pharmacological activities in the field of medicine or pharmacology." |
| Effect: | modulate |
| Effect Info: | "Pharmacological inhibition of 12/15-lipoxygenase inhibits excessive p38 MAPK and ERK but not SAPK/JNK phosphorylation in the sciatic nerves of diabetic mice, alleviates nerve fiber dysfunction, suggesting it may serve as an effective treatment for diabetic peripheral neuropathy." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24175152 |
| Sentence Index: | 24175152_8 |
| Sentence: | "RESULTS: 12(S) HETE concentrations (ELISA), as well as 12/15-lipoxygenase expression and p38 MAPK, ERK, and SAPK/JNK phosphorylation (all by Western blot analysis) were increased in the peripheral nerve and spinal cord of diabetic mice as well as in high glucose-exposed human Schwann cells." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
