| Id: | acc4139 |
| Group: | 1sens |
| Protein: | P38 |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Nervous system diseases |
| Disease: | Cerebral Ischemia |
| Disease Subtype: | Cerebral Ischemic Injury |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | shikonin |
| Drug Info: | Shikonin is a natural naphthoquinone compound with diverse biological activities. It shows potential in anti - inflammation and anti - cancer. |
| Effect: | modulate |
| Effect Info: | The drug inhibits the phosphorylation of p38MAPK in the ischemic cortex and protects the brain from ischemic injury. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24248858 |
| Sentence Index: | 24248858_7 |
| Sentence: | "Compared with vehicle group, 25 mg/kg shikonin significantly improved neurological deficit, decreased infarct volume and edema both at 24 and 72 h after transient ischemic stroke, our data also showed that shikonin inhibited the pro-inflammatory mediators, including TLR4, TNF-alpha, NF-kappaB, and phosphorylation of p38MAPK in ischemic cortex." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
