Id: acc4147
Group: 1sens
Protein: p38
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Cardiovascular and circulatory system diseases
Disease: cardiac dysfunction
Disease Subtype: Endotoxemic
Disease Cellline:
Disease Info:
Drug: norepinephrine
Drug Info: Norepinephrine is a neurotransmitter and hormone. It plays a crucial role in the body's fight - or - flight response.
Effect: modulate
Effect Info: "NE inhibited p38 phosphorylation and NF–κB activation, while promoting ERK1/2 phosphorylation and c–Fos expression, thus improving endotoxin-induced cardiac dysfunction."
Note:
Score: 4.0
Pubmed(PMID): 24304472
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: