Id: acc4164
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Thr185
Site Sequence: HDHTGFLTEYVATRWYRAPEI
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: kidney function
Disease Cellline:
Disease Info:
Drug: "VO(HB(3,5-Me2pz)3)(3,5-Me2pz)(SCN)(SCNH)2"
Drug Info: "The drug is VO(HB(3,5 - Me2pz)3)(3,5 - Me2pz)(SCN)(SCNH)2, which is likely a complex chemical compound with a specific molecular structure."
Effect: modulate
Effect Info: "The phosphorylation levels of p42/p44MAPK and Akt in diabetic mice were significantly increased. After treatment with the novel vanadium oxide complex, the insulin signaling pathway was improved, and the renal function of diabetic mice was enhanced."
Note:
Score: 4.0
Pubmed(PMID): 24636761
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: