| Id: | acc4165 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr187 |
| Site Sequence: | HTGFLTEYVATRWYRAPEIML |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | kidney function |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | "VO(HB(3,5-Me2pz)3)(3,5-Me2pz)(SCN)(SCNH)2" |
| Drug Info: | "The drug is VO(HB(3,5 - Me2pz)3)(3,5 - Me2pz)(SCN)(SCNH)2, which is likely a complex chemical compound with a specific molecular structure." |
| Effect: | modulate |
| Effect Info: | "The phosphorylation levels of p42/p44MAPK and Akt in diabetic mice were significantly increased. After treatment with the novel vanadium oxide complex, the insulin signaling pathway was improved, and the renal function of diabetic mice was enhanced." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24636761 |
| Sentence Index: | 24636761_8 |
| Sentence: | "Additionally, p42/p44MAPK and Akt phosphorylation was markedly increased in diabetic mice and was decreased by treatment with the new oxovanadium complex." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
| T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
| T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
