Id: acc4233
Group: 1sens
Protein: p53
Gene Symbol: Tp53
Protein Id: P10361
Protein Name: P53_RAT
PTM: phosphorylation
Site: Ser15
Site Sequence: SDMSIELPLSQETFSCLWKLL
Disease Category: Urinary and reproductive system diseases
Disease: Fibrosis
Disease Subtype: unilateral ureteral obstruction
Disease Cellline: NRK-49F
Disease Info:
Drug: KU-55933
Drug Info: "KU-55933 is a drug, which may have specific pharmacological effects and applications in medical research."
Effect: modulate
Effect Info: "In a unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU-55933 significantly reduced TGF–β1-induced p54 activation and the expression of fibrosis markers. "
Note:
Score: 4.0
Pubmed(PMID): 25480384
Sentence Index:
Sentence:

Sequence & Structure:

MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: