| Id: | acc4237 |
| Group: | 1sens |
| Protein: | Smad3 |
| Gene Symbol: | Smad3 |
| Protein Id: | Q8BUN5 |
| Protein Name: | SMAD3_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser425 |
| Site Sequence: | SPSIRCSSVS----------- |
| Disease Category: | Urinary and reproductive system diseases |
| Disease: | Fibrosis |
| Disease Subtype: | unilateral ureteral obstruction |
| Disease Cellline: | UUO model |
| Disease Info: | |
| Drug: | KU-55933 |
| Drug Info: | "KU-55933 is a drug, which may have specific pharmacological effects and applications in medical research." |
| Effect: | modulate |
| Effect Info: | "In the unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU - 55933 significantly reduced TGF–β1 - induced p56 activation and the expression of fibrosis markers." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 25480384 |
| Sentence Index: | 25480384_3 |
| Sentence: | "ATM activation (pATM(Ser1981)) increased 4-fold in the tubulointerstitial region of the unilateral ureteral obstruction-injured kidney in mice correlating with SMAD3 and p53(Ser15) phosphorylation and elevated levels of p22(phox) subunit of the NADPH oxidases (NOXs), and fibrotic markers, plasminogen activator inhibitor-1 (PAI-1), and fibronectin, when compared to contralateral (contra) or sham controls." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 204 | D | Obesity | Phosphorylation | 29700281 |
| - | - | D | Chronic kidney disease | Phosphorylation | 23264657 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
