| Id: | acc4238 |
| Group: | 1sens |
| Protein: | Smad3 |
| Gene Symbol: | Smad3 |
| Protein Id: | P84025 |
| Protein Name: | SMAD3_RAT |
| PTM: | phosphorylation |
| Site: | Ser423 |
| Site Sequence: | MGSPSIRCSSVS--------- |
| Disease Category: | Urinary and reproductive system diseases |
| Disease: | Fibrosis |
| Disease Subtype: | unilateral ureteral obstruction |
| Disease Cellline: | HK-2 |
| Disease Info: | |
| Drug: | ATM KO |
| Drug Info: | "ATM KO is a drug, but specific information about it is not provided, and its properties and uses remain unknown." |
| Effect: | modulate |
| Effect Info: | "In a unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU - 55933 significantly reduced TGF–β1 - induced p55 activation and the expression of fibrotic markers." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 25480384 |
| Sentence Index: | 25480384_3 |
| Sentence: | "ATM activation (pATM(Ser1981)) increased 4-fold in the tubulointerstitial region of the unilateral ureteral obstruction-injured kidney in mice correlating with SMAD3 and p53(Ser15) phosphorylation and elevated levels of p22(phox) subunit of the NADPH oxidases (NOXs), and fibrotic markers, plasminogen activator inhibitor-1 (PAI-1), and fibronectin, when compared to contralateral (contra) or sham controls." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
