Id: | acc4239 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Fibrosis |
Disease Subtype: | unilateral ureteral obstruction |
Disease Cellline: | HK-2 |
Disease Info: | |
Drug: | ATM KO |
Drug Info: | "ATM KO is a drug, but specific information about it is not provided, and its properties and uses remain unknown." |
Effect: | modulate |
Effect Info: | "In the unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU - 55933 significantly reduced TGF–β1 - induced p56 activation and the expression of fibrosis markers." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 25480384 |
Sentence Index: | 25480384_3 |
Sentence: | "ATM activation (pATM(Ser1981)) increased 4-fold in the tubulointerstitial region of the unilateral ureteral obstruction-injured kidney in mice correlating with SMAD3 and p53(Ser15) phosphorylation and elevated levels of p22(phox) subunit of the NADPH oxidases (NOXs), and fibrotic markers, plasminogen activator inhibitor-1 (PAI-1), and fibronectin, when compared to contralateral (contra) or sham controls." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.