| Id: | acc4286 |
| Group: | 1sens |
| Protein: | GSK3 |
| Gene Symbol: | Gsk3a |
| Protein Id: | Q2NL51 |
| Protein Name: | GSK3A_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGGGPSGGGPGGSGRARTS |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | type 2 diabetic |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Irisin |
| Drug Info: | "Irisin is a myokine that has been linked to various physiological processes, including energy metabolism and bone health." |
| Effect: | modulate |
| Effect Info: | "In diabetic mice, continuous subcutaneous infusion of Irisin can improve insulin sensitivity, reduce fasting blood glucose levels, increase the phosphorylation levels of GSK3 and Akt, glycogen content, and Irisin levels, and inhibit the phosphorylation of GS and the expression of PEPCK and G6Pase in the liver. " |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26201094 |
| Sentence Index: | 26201094_9 |
| Sentence: | "In diabetic mice, persistent subcutaneous perfusion of irisin improved the insulin sensitivity, reduced fasting blood glucose, increased GSK3 and Akt phosphorylation, glycogen content and irisin level, and suppressed GS phosphorylation and PEPCK and G6Pase expression in the liver." |
Sequence & Structure:
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATVGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPAGPASPLTTSYNPSSQALTEAQTGQDWQPSDATTATLASSS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
