| Id: | acc4299 |
| Group: | 1sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial I/R Injury |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Remifentanil |
| Drug Info: | Remifentanil is a potent opioid analgesic used for the induction and maintenance of anesthesia. It has a rapid onset and short duration of action. |
| Effect: | modulate |
| Effect Info: | Remifentanil preconditioning exerts a protective effect against myocardial ischemia-reperfusion injury by increasing the phosphorylation of STAT3 at Tyr705 and the phosphorylation of GSK-3β. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26468894 |
| Sentence Index: | 26468894_12 |
| Sentence: | "Remifentanil preconditioning reduced postischemic myocardial infarction and hemodynamic dysfunction induced by myocardial ischemia reperfusion injury concomitant with increased phosphorylation of STAT3 at tyr-705 (p-STAT3) and glycogen synthase kinase-3beta but not Akt. AG490 but not wortmannin cancelled remifentanil preconditioning cardioprotection, and SB216763 restored it despite the presence of AG490." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
