Id: acc4310
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: P84025
Protein Name: SMAD3_RAT
PTM: phosphorylation
Site: Ser423
Site Sequence: MGSPSIRCSSVS---------
Disease Category: Systemic diseases
Disease: Peritoneal Fibrosis
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Gefitinib
Drug Info: "Gefitinib is an oral, selective epidermal growth factor receptor tyrosine kinase inhibitor (EGFR-TKI) used in the treatment of certain types of non - small cell lung cancer."
Effect: modulate
Effect Info: "Gefitinib significantly inhibited the phosphorylation of EGFR, Smad3, STAT3, and NF–κB during fibrosis, reduced the overproduction of TGF–β1 and pro - inflammatory cytokines, alleviated macrophage infiltration, and decreased angiogenesis and the increase of related cells after injury."
Note:
Score: 4.0
Pubmed(PMID): 26677863
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: