| Id: | acc4325 |
| Group: | 1sens |
| Protein: | cav-1 |
| Gene Symbol: | Cav1 |
| Protein Id: | P49817 |
| Protein Name: | CAV1_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr14 |
| Site Sequence: | KYVDSEGHLYTVPIREQGNIY |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | Diabetic Nephropathy |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | curcumin |
| Drug Info: | "Curcumin is a natural polyphenol compound commonly found in turmeric, known for its anti - inflammatory and antioxidant properties." |
| Effect: | modulate |
| Effect Info: | "Oral administration of curcumin (100 or 200 mg/kg body weight per day for 8 weeks) not only significantly improved renal function but also inhibited the levels of reactive oxygen species (ROS), oxidative stress, apoptosis, and Cav-1 phosphorylation in the kidneys." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26838071 |
| Sentence Index: | 26838071_12 |
| Sentence: | "In diabetic rats, administration of curcumin (100 or 200 mg/kg body weight per day, ig, for 8 weeks) not only significantly improved the renal function, but also suppressed ROS levels, oxidative stress, apoptosis and cav-1 phosphorylation in the kidneys." |
Sequence & Structure:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
