| Id: | acc4326 |
| Group: | 1sens |
| Protein: | cav-1 |
| Gene Symbol: | Cav1 |
| Protein Id: | P41350 |
| Protein Name: | CAV1_RAT |
| PTM: | phosphorylation |
| Site: | Tyr14 |
| Site Sequence: | KYVDSEGHLYTVPIREQGNIY |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | Diabetic Nephropathy |
| Disease Cellline: | podocyte |
| Disease Info: | |
| Drug: | Curcumin |
| Drug Info: | "Curcumin is a natural polyphenol compound commonly found in turmeric, known for its anti - inflammatory and antioxidant properties." |
| Effect: | modulate |
| Effect Info: | Curcumin alleviates diabetic nephropathy by regulating the phosphorylation of cav - 1. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26838071 |
| Sentence Index: | 26838071_14 |
| Sentence: | Curcumin attenuates high glucose-induced podocyte apoptosis in vitro and diabetic nephropathy in vivo partly through regulating the functional connections between cav-1 phosphorylation and ROS. |
Sequence & Structure:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
