| Id: | acc4340 |
| Group: | 1sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr180 |
| Site Sequence: | LARHTDDEMTGYVATRWYRAP |
| Disease Category: | Nervous system diseases |
| Disease: | Parkinson's Disease |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | desferrioxamine (DFO) |
| Drug Info: | "Desferrioxamine (DFO) is a medication used to remove excess iron from the body, often prescribed for patients with iron overload conditions." |
| Effect: | modulate |
| Effect Info: | "p38 phosphorylation activation is associated with the upregulation of HIF-1α and neuroprotective effects, and may function by regulating stress responses and cell survival." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26996132 |
| Sentence Index: | 26996132_5 |
| Sentence: | "Treatment with DFO efficiently alleviated behavioral deficits, increased the survival of tyrosine hydroxylase (TH)-positive neurons, and decreased the action of astrocytes in the SN and striatum in an MPTP-induced PD mouse model." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
