| Id: | acc4354 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr185 |
| Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
| Disease Category: | Immune system diseases |
| Disease: | Atopic Dermatitis |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | ?Benzoxaborole Phosphodiesterase Inhibitors |
| Drug Info: | "Benzoxaborole Phosphodiesterase Inhibitors are a type of drug that can inhibit phosphodiesterase, potentially having various therapeutic applications." |
| Effect: | modulate |
| Effect Info: | "Treatment with compound 3 (compd3) or N(6),2'-O-dibutyryladenosine 3',5'-cyclic monophosphate can increase the phosphorylation of cAMP response element-binding protein (CREB) in human monocytes and decrease the phosphorylation of extracellular signal-regulated kinase (ERK) in human T cells." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 27353073 |
| Sentence Index: | 27353073_6 |
| Sentence: | "In cell culture, benzoxaborole PDE4 inhibitors suppress the release of tumor necrosis factor-alpha, interleukin (IL)-23, IL-17, interferon-gamma, IL-4, IL-5, IL-13, and IL-22, and these cytokines contribute to the pathologic changes in skin structure and barrier functions as well as immune dysregulation in atopic dermatitis and psoriasis." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
| T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
| T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
