| Id: | acc4379 |
| Group: | 1sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cerebral Ischemia |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Wortmannin |
| Drug Info: | Wortmannin is a fungal metabolite that is a potent and specific inhibitor of phosphoinositide 3 - kinases. |
| Effect: | modulate |
| Effect Info: | "ME-induced cerebral ischemia upregulates the phosphorylation of Akt and GSK-3β, while Wortmannin can reverse this process." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 27866373 |
| Sentence Index: | 27866373_8 |
| Sentence: | Treatment with a phosphatidylinositol 3-kinase (PI3-K) inhibitor decreased the cerebral ischemia-induced phosphorylation of Akt and that of GSK-3beta at its Ser9. |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
