Id: | acc4381 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | Q8BUN5 |
Protein Name: | SMAD3_MOUSE |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Renal Fibrosis |
Disease Subtype: | Obstructive Nephropathy |
Disease Cellline: | |
Disease Info: | |
Drug: | dasatinib |
Drug Info: | Dasatinib is a medication used in the treatment of certain types of leukemia. It functions as a tyrosine - kinase inhibitor to block abnormal protein signaling in cancer cells. |
Effect: | modulate |
Effect Info: | "In a mouse model of unilateral ureteral obstruction, dasatinib can significantly inhibit the phosphorylation of Smad3 and the occurrence of related fibrotic phenotypes." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 27927780 |
Sentence Index: | 27927780_7 |
Sentence: | "In a murine model with unilateral ureteric obstruction, pretreatment with dasatinib significantly reduced the upregulation of profibrotic markers, phosphorylation of Smad3, and renal fibrosis observed in kidneys pretreated with vehicle alone." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 204 | D | Obesity | Phosphorylation | 29700281 |
- | - | D | Chronic kidney disease | Phosphorylation | 23264657 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.