Id: | acc4397 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser423 |
Site Sequence: | MGSPSIRCSSVS--------- |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Hyperuricemic Nephropathy |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | U0126 |
Drug Info: | "U0126 is a drug, but specific details about it are not provided." |
Effect: | modulate |
Effect Info: | "U0126 inhibits the phosphorylation of ERK1/2 and Smad3, and alleviates hyperuricemic nephropathy in rats." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 28442634 |
Sentence Index: | 28442634_3 |
Sentence: | "In a rat model of HN induced by feeding mixture of adenine and potassium oxonate, increased ERK1/2 phosphorylation and severe glomerular sclerosis and renal interstitial fibrosis were evident, in parallel with diminished levels of renal function and increased urine microalbumin excretion." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.