Id: | acc4405 |
Group: | 1sens |
Protein: | FOXO1 |
Gene Symbol: | Foxo1 |
Protein Id: | Q9R1E0 |
Protein Name: | FOXO1_MOUSE |
PTM: | phosphorylation |
Site: | Ser256 |
Site Sequence: | PRRRAASMDNNSKFAKSRGRA |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Glucose Intolerance and Insulin Resistance |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | HCV infection |
Drug Info: | "HCV infection refers to the infection caused by the Hepatitis C virus, which can lead to liver - related diseases." |
Effect: | modulate |
Effect Info: | "In primary hepatocytes of FL - N/35 transgenic mice expressing HCV, the normal phosphorylation of key proteins (such as IRS2 and PDK1) in the insulin signaling pathway is disrupted, thereby impairing insulin function. (Phosphorylation of IRS2, PDK1, Thr308 of Akt, and FoxO1 is down - regulated, while phosphorylation of Ser473 of Akt is up - regulated. For PKC?:Ser728, GSK3α/β:S21/9, and p70S6K:Thr389, there is no significant difference, so they are not listed in the table. The antibody used for IRS2 phosphorylation is not stated in the attached table.) " |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 28559285 |
Sentence Index: | 28559285_5 |
Sentence: | "Early steps of the hepatic insulin signaling pathway, from IRS2 to PDK1 phosphorylation, were constitutively impaired in FL-N/35 primary hepatocytes via deregulation of TNFalpha/SOCS3." |
Sequence & Structure:
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.