| Id: | acc4465 |
| Group: | 1sens |
| Protein: | PPARgamma |
| Gene Symbol: | Pparg |
| Protein Id: | P37238 |
| Protein Name: | PPARG_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser273 |
| Site Sequence: | ILTGKTTDKSPFVIYDMNSLM |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | 3T3–L1 |
| Disease Info: | |
| Drug: | Dihydrosanguinarine |
| Drug Info: | Dihydrosanguinarine is a drug with certain pharmacological properties and may be used in related medical research. |
| Effect: | modulate |
| Effect Info: | "DHS mediates its stimulatory effects on adipocyte differentiation and insulin sensitivity by inhibiting AMPKα, upregulating the expression of PPARγ and its target genes (such as Glut–4 and adiponectin), and reducing PPARγ phosphorylation. At the effective concentration (5 μM), DHS significantly increases glucose uptake." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 29202114 |
| Sentence Index: | 29202114_1 |
| Sentence: | "Recently, more studies have aimed at identifying selective peroxisome proliferator-activated receptor gamma (PPARgamma) modulators that transactivate the expression of PPARgamma-dependent genes as partial agonists to improve diabetic symptoms with fewer side effects compared to classic PPARgamma agonists such as thiazolidinediones." |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
