Id: | acc4488 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | Q8BUN5 |
Protein Name: | SMAD3_MOUSE |
PTM: | phosphorylation |
Site: | Ser423 |
Site Sequence: | MGSPSIRCSSVS--------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiac Fibrosis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Rosmarinic acid |
Drug Info: | "Rosmarinic Acid is a natural phenolic compound that has antioxidant, anti - inflammatory, and antimicrobial properties. It is often found in plants such as rosemary and mint." |
Effect: | modulate |
Effect Info: | Rosmarinic acid (RA) alleviates cardiac fibrosis caused by long-term pressure overload through the AMPKα/Smad3 signaling pathway. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 29367637 |
Sentence Index: | 29367637_11 |
Sentence: | RA attenuated cardiac fibrosis following long-term pressure overload via AMPKalpha/Smad3 signaling and PPAR-gamma was required for the activation of AMPKalpha. |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 204 | D | Obesity | Phosphorylation | 29700281 |
- | - | D | Chronic kidney disease | Phosphorylation | 23264657 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.