Id: acc4492
Group: 1sens
Protein: HSP27
Gene Symbol: Hspb1
Protein Id: P42930
Protein Name: HSPB1_RAT
PTM: phosphorylation
Site: Ser85
Site Sequence: AFSRALNRQLSSGVSEIRQTA
Disease Category: Cardiovascular and circulatory system diseases
Disease: Cerebral Ischemia
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: KU–55933
Drug Info: KU–55933 is a specific drug. It may be used in relevant medical research or treatment.
Effect: modulate
Effect Info: The activation of G6PD through ATM kinase-mediated HSP27 phosphorylation may be part of the endogenous antioxidant defense neuroprotective mechanism activated during ischemia-reperfusion. The ATM kinase inhibitor KU–55933 can reduce HSP27 phosphorylation and increase the infarct size.
Note:
Score: 4.0
Pubmed(PMID): 29510140
Sentence Index:
Sentence:

Sequence & Structure:

MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTLARPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSGAK

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: