Id: acc4505
Group: 1sens
Protein: P38
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Cardiovascular and circulatory system diseases
Disease: Myocardial I/R Injury
Disease Subtype: "Mi/R (Myocardial Ischaemia/Reperfusion) Injury, t
Disease Cellline:
Disease Info:
Drug: Butorphanol
Drug Info: Butorphanol is a synthetic opioid analgesic used to relieve moderate to severe pain. It acts on the opioid receptors in the brain to produce pain - relieving effects.
Effect: modulate
Effect Info: "The drug reduces the phosphorylation levels of p38 and JNK, decreases the myocardial infarction area, and alleviates the disease symptoms."
Note:
Score: 4.0
Pubmed(PMID): 29630131
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: