| Id: | acc4525 |
| Group: | 1sens |
| Protein: | p38 |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | Phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial Infarction |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Atorvastatin |
| Drug Info: | Atorvastatin is a medication used to lower cholesterol levels and reduce the risk of heart disease. |
| Effect: | modulate |
| Effect Info: | Drugs inhibit p38 phosphorylation and improve symptoms of myocardial infarction. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 30116330 |
| Sentence Index: | 30116330_10 |
| Sentence: | "Atorvastatin can improve cardiac remodeling after myocardial infarction in rats, which may be associated with its inhibition of p38 phosphorylation and its decrease of TNF-alpha expression." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
