| Id: | acc4547 |
| Group: | 1sens |
| Protein: | histone H3 |
| Gene Symbol: | H3-3b |
| Protein Id: | P84245 |
| Protein Name: | H33_RAT |
| PTM: | acetylation |
| Site: | Lys9 |
| Site Sequence: | -MARTKQTARKSTGGKAPRKQ |
| Disease Category: | Nervous system diseases |
| Disease: | Depression |
| Disease Subtype: | depressive |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Venlafaxine (VEN) |
| Drug Info: | "Venlafaxine (VEN) is an antidepressant commonly used to treat major depressive disorder, anxiety disorders, and panic disorder." |
| Effect: | modulate |
| Effect Info: | "Long - term VEN treatment can significantly relieve anxiety - and depression - like behaviors in CUS rats, and prevent the increase in histone deacetylase 5 expression and the decrease in acH3K9 levels. " |
| Note: | histone |
| Score: | 3.0 |
| Pubmed(PMID): | 30640193 |
| Sentence Index: | 30640193_0 |
| Sentence: | Antidepressant mechanisms of venlafaxine involving increasing histone acetylation and modulating tyrosine hydroxylase and tryptophan hydroxylase expression in hippocampus of depressive rats. |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
