Id: acc4550
Group: 1sens
Protein: p38 MAP kinase
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Thr180/Tyr182
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Hypertension
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: CoQ10
Drug Info: "CoQ10, also known as coenzyme Q10, is an antioxidant that helps the body produce energy and supports heart health."
Effect: modulate
Effect Info: "CoQ10 reduces blood pressure by enhancing the phosphorylation of Akt and nNOS in the NTS, decreasing the phosphorylation level of p38, and promoting NO production."
Note:
Score: 4.0
Pubmed(PMID): 30668894
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: