| Id: | acc4566 |
| Group: | 1sens |
| Protein: | PLN |
| Gene Symbol: | Pln |
| Protein Id: | P61016 |
| Protein Name: | PPLA_RAT |
| PTM: | phosphorylation |
| Site: | Ser16 |
| Site Sequence: | LTRSAIRRASTIEMPQQARQN |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Hypertrophy |
| Disease Subtype: | |
| Disease Cellline: | H9c2 |
| Disease Info: | |
| Drug: | lithocholic acid (LCA) |
| Drug Info: | Lithocholic acid (LCA) is a secondary bile acid derived from the metabolism of primary bile acids. It is involved in various physiological processes in the body. |
| Effect: | modulate |
| Effect Info: | Lithocholic acid (LCA) activates TGR5 → ↑PKA → ↑phosphorylation of PLN → ↑SERCA2a activity → ↓cytoplasmic Ca?? + ↓calcineurin/NFAT → ↓cardiac hypertrophy |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 30842472 |
| Sentence Index: | 30842472_9 |
| Sentence: | "In conclusion, TGR5 activation stimulated protein kinase A (PKA) to enhance PLN phosphorylation, which activated SERCA2a to remove Ca2+ from cytosol to sarcoplasmic reticulum in addition to the reduction of calcineurin/NFAT pathway signaling to ameliorate the hyperglycemia-induced cardiac hypertrophy shown in cardiomyocytes." |
Sequence & Structure:
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
