Id: acc4592
Group: 1sens
Protein: P38
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Nervous system diseases
Disease: Neuronal Loss
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: LPS
Drug Info: "LPS, or lipopolysaccharide, is a large molecule consisting of a lipid and a polysaccharide that is a component of the outer membrane of Gram-negative bacteria."
Effect: modulate
Effect Info: "LPS increases the phosphorylation of p38 MAPK, the expression of TNF-α and IL-6, and neuronal loss."
Note:
Score: 4.0
Pubmed(PMID): 31124385
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: